PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN27311.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 273aa    MW: 30884.9 Da    PI: 7.5779
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN27311.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.31.3e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+lv+++++ Gg+ +W++ ++  g+ R++k+c++rw +yl
       KHN27311.1 14 KGPWTAEEDEILVNYINKNGGHgSWRSLPNLAGLLRCGKSCRLRWTNYL 62
                     79*******************9***********99************97 PP

2Myb_DNA-binding461.2e-1468113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T e+++l+++++  lG++ W++Ia+ ++ gRt++++k+ w+++l
       KHN27311.1  68 RGSFTLEDEKLIIQLHGILGNR-WAAIASQLP-GRTDNEIKNLWNTHL 113
                      899*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-22565IPR009057Homeodomain-like
PROSITE profilePS5129415.668962IPR017930Myb domain
SuperFamilySSF466893.74E-2810109IPR009057Homeodomain-like
SMARTSM007178.1E-121364IPR001005SANT/Myb domain
PfamPF002491.7E-141462IPR001005SANT/Myb domain
CDDcd001674.26E-81662No hitNo description
PROSITE profilePS5129423.53163117IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-2466118IPR009057Homeodomain-like
SMARTSM007171.3E-1367115IPR001005SANT/Myb domain
PfamPF002491.3E-1368113IPR001005SANT/Myb domain
CDDcd001672.15E-970113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MGRKPCCDKM GLKKGPWTAE EDEILVNYIN KNGGHGSWRS LPNLAGLLRC GKSCRLRWTN  60
YLRPDIKRGS FTLEDEKLII QLHGILGNRW AAIASQLPGR TDNEIKNLWN THLKKRLICM  120
GLDPQTHQPL ASPHNPNDKA HASSSTSTRH MAQWESARLE AEARLSREPH LYNNNNKTDS  180
DYFLRIWNSD LGESFRDVHK LESSIKCESQ SATTDLASLT PASIVKEEFL WGVKKIVSDS  240
SSSSSELHHD SCDTSLQLLL DFPMNNDMSF LEL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-27121175108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150422e-99AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003521908.10.0PREDICTED: myb-related protein Zm38-like
SwissprotQ50EX65e-64ODO1_PETHY; Protein ODORANT1
TrEMBLA0A0B2R0610.0A0A0B2R061_GLYSO; Protein ODORANT1
STRINGGLYMA03G01540.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23313280
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.11e-120myb domain protein 17
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]